PCDHA6 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-PCDHA6 antibody is: synthetic peptide directed towards the N-terminal region of Human PCDHA6. Synthetic peptide located within the following region: LAAWKVGSGQLHYSVPEEAKHGTFVGRIAQDLGLELAELVPRLFRMASKD
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	75 kDa
Gene Name	protocadherin alpha 6
Database Link	NP_114037 Entrez Gene 56142 Human UniProt ID Q9UN73
Background	PCDHA6 is a potential calcium-dependent cell-adhesion protein, It may be involved in the establishment and maintenance of specific neuronal connections in the brain.
Synonyms	CNR2; CNRN2; CNRS2; CRNR2; PCDH-ALPHA6
Note	Immunogen Sequence Homology: Human: 100%; Mouse: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Guinea pig: 93%; Rabbit: 92%; Horse: 86%; Bovine: 86%; Zebrafish: 85%
Reference Data
Protein Families	Secreted Protein, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.