CDCA4 Rabbit Polyclonal Antibody
CAT#: TA339729
Rabbit Polyclonal Anti-CDCA4 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4,537.00
CNY 300.00
CNY 1,430.00
CNY 3,080.00
CNY 3,080.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-CDCA4 antibody: synthetic peptide directed towards the N terminal of human CDCA4. Synthetic peptide located within the following region: MFARGLKRKCVGHEEDVEGALAGLKTVSSYSLQRQSLLDMSLVKLQLCHM |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Purification | Protein A purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 26 kDa |
Gene Name | cell division cycle associated 4 |
Database Link | |
Background | The function of this gene is not known, but its existence is supported by mRNAs and EST data. A similar gene in mice was found to be expressed preferentially in hematopoietic progenitors and mature blood cells.The function of this gene is not known, but its existence is supported by mRNAs and EST data. A similar gene in mice was found to be expressed preferentially in hematopoietic progenitors and mature blood cells. Two alternatively spliced transcript variants encoding the same protein have been noted for this gene. |
Synonyms | HEPP; SEI-3 |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Zebrafish: 100%; Guinea pig: 100%; Rat: 92%; Mouse: 92% |
Reference Data | |
Protein Families | ES Cell Differentiation/IPS |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |