Sorbs1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Sorbs1 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Sorbs1. Synthetic peptide located within the following region: PQAQQRRVTPDRSQPSLDLCSYQALYSYVPQNDDELELRDGDIVDVMEKC
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	103 kDa
Gene Name	sorbin and SH3 domain containing 1
Database Link	NP_848139 Entrez Gene 20411 Mouse UniProt ID Q62417
Background	The function of this protein remains unknown.
Synonyms	CAP; DKFZp451C066; DKFZp586P1422; FLAF2; FLJ12406; KIAA0894; KIAA1296; OTTHUMP00000020142; OTTHUMP00000020143; OTTHUMP00000020144; OTTHUMP00000020145; ponsin; R85FL; SH3D5; SH3P12; SORB1
Note	Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Dog: 93%; Horse: 93%; Rabbit: 93%; Guinea pig: 93%; Zebrafish: 92%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.