Ap4s1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Ap4s1 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Ap4s1. Synthetic peptide located within the following region: KFFLMVNKQGQTRLSKYYEHVDINKRALLETEVSKSCLSRSSEQCSFIEY
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	16 kDa
Gene Name	adaptor-related protein complex AP-4, sigma 1
Database Link	NP_068356 Entrez Gene 11782 Mouse UniProt ID Q9WVL1
Background	Ap4s1 is a subunit of novel type of clathrin- or non-clathrin-associated protein coat involved in targeting proteins from the trans-Golgi network (TGN) to the endosomal-lysosomal system.
Synonyms	AP47B; CLA20; CLAPS4; FLJ32366; Sigma4-adaptin
Note	Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%; Goat: 86%; Yeast: 75%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.