SERPINB1 Rabbit Polyclonal Antibody

CAT#: TA340203

Rabbit Polyclonal Anti-SERPINB1 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5,250.00


货期*
6周

规格
    • 50 ug

Cited in 1 publication.

Product images

经常一起买 (4)
Transient overexpression lysate of serpin peptidase inhibitor, clade B (ovalbumin), member 1 (SERPINB1)
    • 100 ug

CNY 3,080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00


Recombinant protein of human serpin peptidase inhibitor, clade B (ovalbumin), member 1 (SERPINB1), 20 µg
    • 20 ug

CNY 2,900.00
CNY 6,650.00


Recombinant protein of human serpin peptidase inhibitor, clade B (ovalbumin), member 1 (SERPINB1), 100 µg
    • 100 ug

CNY 9,998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-SERPINB1 antibody: synthetic peptide directed towards the middle region of human SERPINB1. Synthetic peptide located within the following region: RVLELPYQGEELSMVILLPDDIEDESTGLKKIEEQLTLEKLHEWTKPENL
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 43 kDa
Gene Name serpin family B member 1
Background SERPINB1 regulates the activity of the neutrophil proteases elastase, cathepsin G, proteinase-3, chymase, chymotrypsin, and kallikrein-3.
Synonyms EI; ELANH2; HEL-S-27; HEL57; LEI; M; MNEI; NEI; PI-2; PI2
Note Immunogen Sequence Homology: Human: 100%; Dog: 93%; Mouse: 93%; Rat: 92%; Sheep: 86%; Bovine: 86%; Horse: 85%; Pig: 77%
Reference Data
Protein Families Druggable Genome
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)

Customer Reviews 
Loading...