NCE2 (UBE2F) Rabbit Polyclonal Antibody

CAT#: TA340245

Rabbit Polyclonal Anti-UBE2F Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5,250.00


货期*
6周

规格
    • 100 ul

Product images

经常一起买 (4)
Transient overexpression lysate of ubiquitin-conjugating enzyme E2F (putative) (UBE2F)
    • 100 ug

CNY 3,080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00


Recombinant protein of human ubiquitin-conjugating enzyme E2F (putative) (UBE2F), 20 µg
    • 20 ug

CNY 2,900.00
CNY 6,650.00


Recombinant protein of human ubiquitin-conjugating enzyme E2F (putative) (UBE2F), 100 µg
    • 100 ug

CNY 9,998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-UBE2F antibody: synthetic peptide directed towards the middle region of human UBE2F. Synthetic peptide located within the following region: TLKDVVWGLNSLFTDLLNFDDPLNIEAAEHHLRDKEDFRNKVDDYIKRYA
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 21 kDa
Gene Name ubiquitin conjugating enzyme E2 F (putative)
Background UBE2F belongs to the ubiquitin-conjugating enzyme family. UBE2F accepts the ubiquitin-like protein NEDD8 from the UBA3-NAE1 E1 complex and catalyzes its covalent attachment to other proteins.
Synonyms NCE2
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%; Yeast: 79%
Reference Data
Protein Pathways Ubiquitin mediated proteolysis
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...