PPM1M Rabbit Polyclonal Antibody
CAT#: TA340345
Rabbit Polyclonal Anti-PPM1M Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5,250.00
CNY 3,080.00
CNY 300.00
CNY 1,430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-PPM1M antibody: synthetic peptide directed towards the middle region of human PPM1M. Synthetic peptide located within the following region: RRLKGDDLGQKVLFRDHHMSGWSYKRVEKSDLKYPLIHGQGRQARLLGTL |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | lot specific |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 27 kDa |
Gene Name | protein phosphatase, Mg2+/Mn2+ dependent 1M |
Database Link | |
Background | PPM1M belongs to the PP2C family. It contains 1 PP2C-like domain. The exact function of PPM1M is not known. |
Synonyms | PP2C-eta; PP2CE; PP2Ceta |
Note | Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Dog: 93%; Bovine: 93%; Rabbit: 93%; Horse: 92% |
Reference Data | |
Protein Families | Druggable Genome, Phosphatase |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |