RECQL5 Rabbit Polyclonal Antibody
CAT#: TA341562
Rabbit Polyclonal Anti-RECQL5 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4,628.00
CNY 300.00
CNY 1,430.00
CNY 3,080.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-RECQL5 antibody: synthetic peptide directed towards the middle region of human RECQL5. Synthetic peptide located within the following region: CDHCQNPTAVRRRLEALERSSSWSKTCIGPSQGNGFDPELYEGGRKGYGD |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 109 kDa |
Gene Name | RecQ like helicase 5 |
Database Link | |
Background | The protein encoded byThis gene is a helicase that is important for genome stability.The encoded protein also prevents aberrant homologous recombination by displacing RAD51 from ssDNA. Three transcript variants encoding different isoforms have been found forThis gene. [provided by RefSeq, Jul 2011] |
Synonyms | RECQ5 |
Note | Immunogen Sequence Homology: Human: 100%; Zebrafish: 91%; Dog: 86%; Rat: 86%; Horse: 86%; Mouse: 86%; Bovine: 86%; Rabbit: 86%; Pig: 79%; Guinea pig: 79% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |