Annexin VI (ANXA6) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ANXA6 antibody: synthetic peptide directed towards the N terminal of human ANXA6. Synthetic peptide located within the following region: ALYTAMKGFGSDKEAILDIITSRSNRQRQEVCQSYKSLYGKDLIADLKYE
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	74 kDa
Gene Name	annexin A6
Database Link	NP_001146 Entrez Gene 309 Human UniProt ID P08133
Background	Annexin VI belongs to a family of calcium-dependent membrane and phospholipid binding proteins. Several members ofThe annexin family have been implicated in membrane-related events along exocytotic and endocytotic pathways.The annexin VI gene is approximately 60 kbp long and contains 26 exons. It encodes a protein of about 68 kDa that consists of eight 68-amino acid repeats separated by linking sequences of variable lengths. It is highly similar to human annexins I and II sequences, each of which contain four such repeats. Annexin VI has been implicated in mediatingThe endosome aggregation and vesicle fusion in secreting epithelia during exocytosis. Alternatively spliced transcript variants have been described. [provided by RefSeq, Aug 2010]
Synonyms	ANX6; CBP68
Note	Immunogen Sequence Homology: Human: 100%; Rat: 93%; Zebrafish: 93%; Dog: 86%; Pig: 86%; Horse: 86%; Bovine: 86%; Rabbit: 85%; Guinea pig: 85%; Mouse: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.