GJA5 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-GJA5 antibody: synthetic peptide directed towards the N terminal of human GJA5. Synthetic peptide located within the following region: STPSLVYMGHAMHTVRMQEKRKLREAERAKEVRGSGSYEYPVAEKAELSC
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	39 kDa
Gene Name	gap junction protein alpha 5
Database Link	NP_005257 Entrez Gene 2702 Human UniProt ID P36382
Background	This gene is a member ofThe connexin gene family.The encoded protein is a component of gap junctions, which are composed of arrays of intercellular channels that provide a route forThe diffusion of low molecular weight materials from cell to cell. Mutations inThis gene may be associated with atrial fibrillation. Alternatively spliced transcript variants encodingThe same isoform have been described. [provided by RefSeq, Jul 2008]
Synonyms	ATFB11; CX40
Note	Immunogen Sequence Homology: Human: 100%; Pig: 93%; Dog: 86%; Rabbit: 82%; Rat: 79%; Horse: 79%; Bovine: 79%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.