Dlx4 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-DLX4 antibody: synthetic peptide directed towards the N terminal of mouse DLX4. Synthetic peptide located within the following region: YSHPGPATPGDSYLPRQQQLVAPSQPFHRPAEHPQELEAESEKLALSLVP
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	26 kDa
Gene Name	distal-less homeobox 4
Database Link	NP_031893 Entrez Gene 13394 Mouse UniProt ID P70436
Background	May play a role in determiningThe production of hemoglobin S. May act as a repressor.
Synonyms	BP1; DLX-7; DLX-8; DLX7; DLX8; DLX9
Note	Immunogen Sequence Homology: Human: 100%; Mouse: 100%; Rat: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.