FOXD2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Foxd2 antibody: synthetic peptide directed towards the c terminal of mouse Foxd2. Synthetic peptide located within the following region: GPGGQAQVLAMLTAPALTPVAGHIRLSHPGDSLLSSGPSFASKVAGLSGC
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	49
Gene Name	forkhead box D2
Database Link	NP_004465 Entrez Gene 17301 Mouse UniProt ID O60548
Background	Foxd2 is a probable transcription factor involved in embryogenesis and somatogenesis.
Synonyms	FKHL17; FREAC-9; FREAC9
Note	Immunogen Sequence Homology: Rat: 100%; Mouse: 100%; Pig: 86%; Bovine: 86%; Guinea pig: 86%; Horse: 79%; Human: 79%
Reference Data
Protein Families	Druggable Genome, Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.