Tmed1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Rat, Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Tmed1 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: EAGPPPIQDGEFTFLLPAGRKQCFYQSAPANASLETEYQVIGGAGLDVDF
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	25 kDa
Gene Name	transmembrane p24 trafficking protein 1
Database Link	NP_001013450 Entrez Gene 11018 HumanEntrez Gene 315461 Rat UniProt ID Q5BK85
Background	Potential role in vesicular protein trafficking, mainly inThe early secretory pathway. May act as a cargo receptor atThe lumenal side for incorporation of secretory cargo molecules into transport vesicles and may be involved in vesicle coat formation atThe cytoplasmic side.
Synonyms	Il1rl1l; IL1RL1LG; MGC1270; ST2L
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 91%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.