MMP23 (MMP23B) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-MMP23B antibody: synthetic peptide directed towards the N terminal of human MMP23B. Synthetic peptide located within the following region: ILSFPRNLLSPRETRRALAAAFRMWSDVSPFSFREVAPEQPSDLRIGFYP
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	36 kDa
Gene Name	matrix metallopeptidase 23B
Database Link	NP_008914 Entrez Gene 8510 Human UniProt ID O75900
Background	This gene (MMP23B) encodes a member ofThe matrix metalloproteinase (MMP) family, and it is part of a duplicated region of chromosome 1p36.3. Proteins ofThe matrix metalloproteinase (MMP) family are involved inThe breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis.This gene belongs toThe more telomeric copy ofThe duplicated region. [provided by RefSeq, Jul 2008]
Synonyms	MIFR; MIFR-1; MMP22; MMP23A
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Zebrafish: 79%
Reference Data
Protein Families	Druggable Genome, Protease, Secreted Protein, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.