UGT1A4 Rabbit Polyclonal Antibody

CAT#: TA341883

Rabbit Polyclonal Anti-UGT1A4 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5,250.00


货期*
6周

规格
    • 50 ug

Product images

经常一起买 (4)
Transient overexpression lysate of UDP glucuronosyltransferase 1 family, polypeptide A4 (UGT1A4)
    • 100 ug

CNY 4,840.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00


Recombinant protein of human UDP glucuronosyltransferase 1 family, polypeptide A4 (UGT1A4), 20 µg
    • 20 ug

CNY 2,900.00
CNY 6,650.00


Recombinant protein of human UDP glucuronosyltransferase 1 family, polypeptide A4 (UGT1A4), 100 µg
    • 100 ug

CNY 9,998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-UGT1A4 antibody: synthetic peptide directed towards the N terminal of human UGT1A4. Synthetic peptide located within the following region: VVLTPEVNMHIKEEKFFTLTAYAVPWTQKEFDRVTLGYTQGFFETEHLLK
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 57 kDa
Gene Name UDP glucuronosyltransferase family 1 member A4
Background This gene encodes a UDP-glucuronosyltransferase, an enzyme ofThe glucuronidation pathway that transforms small lipophilic molecules, such as steroids, bilirubin, hormones, and drugs, into water-soluble, excretable metabolites.This gene is part of a complex locus that encodes several UDP-glucuronosyltransferases.The locus includes thirteen unique alternate first exons followed by four common exons. Four ofThe alternate first exons are considered pseudogenes. Each ofThe remaining nine 5' exons may be spliced toThe four common exons, resulting in nine proteins with different N-termini and identical C-termini. Each first exon encodesThe substrate binding site, and is regulated by its own promoter.This enzyme has some glucuronidase activity towards bilirubin, although is is more active on amines, steroids, and sapogenins. [provided by RefSeq, Jul 2008]
Synonyms HUG-BR2; UDPGT; UDPGT 1-4; UGT-1D; UGT1-04; UGT1.4; UGT1A4S; UGT1D
Note Immunogen Sequence Homology: Human: 100%
Reference Data
Protein Families Transmembrane
Protein Pathways Androgen and estrogen metabolism, Ascorbate and aldarate metabolism, Drug metabolism - cytochrome P450, Drug metabolism - other enzymes, Metabolic pathways, Metabolism of xenobiotics by cytochrome P450, Pentose and glucuronate interconversions, Porphyrin and chlorophyll metabolism, Retinol metabolism, Starch and sucrose metabolism
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...