TMED3 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-TMED3 antibody: synthetic peptide directed towards the C terminal of human TMED3. Synthetic peptide located within the following region: DRARAEDLNSRVSYWSVGETIALFVVSFSQVLLLKSFFTEKRPISRAVHS
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	25 kDa
Gene Name	transmembrane p24 trafficking protein 3
Database Link	NP_031390 Entrez Gene 23423 Human UniProt ID Q9Y3Q3
Background	The function remains known.
Synonyms	C15orf22; P24B; p26
Note	Immunogen Sequence Homology: Human: 100%; Rat: 93%; Horse: 93%; Bovine: 93%; Pig: 86%; Mouse: 86%; Guinea pig: 86%; Dog: 79%; Rabbit: 79%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.