ABI3BP Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-ABI3BP antibody is: synthetic peptide directed towards the C-terminal region of Human ABI3BP. Synthetic peptide located within the following region: PVSNTVAFSTESADPRVSEPVSAGRDAIWTERPFNSDSYSECKGKQYVKR
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	53 kDa
Gene Name	ABI family member 3 binding protein
Database Link	NP_056244 Entrez Gene 25890 Human UniProt ID Q7Z7G0
Background	ABI3BP contains 2 fibronectin type-III domains.The loss of ABI3BP expression could play a functional role in thyroid tumorigenesis. It also presumably represents a trigger gene for evoking cellular senescence, which has also been suggested to be involved inThe prevention of tumorigenesis.
Synonyms	NESHBP; TARSH
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Rat: 93%; Mouse: 93%; Guinea pig: 93%
Reference Data
Protein Families	Druggable Genome, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.