RHBDL2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-RHBDL2 antibody is: synthetic peptide directed towards the N-terminal region of Human RHBDL2. Synthetic peptide located within the following region: ELEEEEKMREDGGGKDRAKSKKVHRIVSKWMLPEKSRGTYLERANCFPPP
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	40 kDa
Gene Name	rhomboid like 2
Database Link	NP_060291 Entrez Gene 54933 Human UniProt ID Q9NX52
Background	The protein encoded byThis gene is a member ofThe rhomboid family of integral membrane proteins.This family contains proteins that are related to Drosophila rhomboid protein. Members ofThis family are found in both prokaryotes and eukaryotes and are thought to function as intramembrane serine proteases.The encoded protein is thought to release soluble growth factors by proteolytic cleavage of certain membrane-bound substrates, including ephrin B2 and ephrin B3. [provided by RefSeq, Jul 2008]
Synonyms	RRP2
Note	Immunogen Sequence Homology: Human: 100%
Reference Data
Protein Families	Protease, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.