TCEAL4 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-TCEAL4 antibody: synthetic peptide directed towards the middle region of human TCEAL4. Synthetic peptide located within the following region: GSETRAAGKRPAEDDVPRKAKRKTNKGLAHYLKEYKEAIHDMNFSNEDMI
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	25 kDa
Gene Name	transcription elongation factor A like 4
Database Link	NP_001006938 Entrez Gene 79921 Human UniProt ID Q96EI5
Background	TCEAL4 is a member ofThe transcription elongation factor A (SII)-like (TCEAL) gene family. Members ofThis family contain TFA domains and may function as nuclear phosphoproteins that modulate transcription in a promoter context-dependent manner. Multiple family members are located onThe X chromosome.This gene encodes a member ofThe transcription elongation factor A (SII)-like (TCEAL) gene family. Members ofThis family contain TFA domains and may function as nuclear phosphoproteins that modulate transcription in a promoter context-dependent manner. Multiple family members are located onThe X chromosome. Alternative splicing occurs forThis gene; however,The full-length nature of all transcript variants has not yet been described.
Synonyms	NPD017; WEX7
Note	Immunogen Sequence Homology: Horse: 100%; Human: 100%; Rabbit: 100%; Pig: 92%; Bovine: 92%; Rat: 90%; Dog: 85%; Mouse: 85%; Guinea pig: 85%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.