Proteasome 20S beta 6 (PSMB6) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-PSMB6 antibody: synthetic peptide directed towards the N terminal of human PSMB6. Synthetic peptide located within the following region: TTIMAVQFDGGVVLGADSRTTTGSYIANRVTDKLTPIHDRIFCCRSGSAA
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	25 kDa
Gene Name	proteasome subunit beta 6
Database Link	NP_002789 Entrez Gene 5694 Human UniProt ID P28072
Background	The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure.The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway.The encoded protein is a member ofThe proteasome B-type family, also known asThe T1B family, and is a 20S core beta subunit inThe proteasome. Alternatively spliced transcript variants encoding multiple isoforms have been observed forThis gene. [provided by RefSeq, Jul 2012]
Synonyms	DELTA; LMPY; Y
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Yeast: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%
Reference Data
Protein Families	Druggable Genome, Protease
Protein Pathways	Proteasome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.