SFRP2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-SFRP2 antibody: synthetic peptide directed towards the middle region of human SFRP2. Synthetic peptide located within the following region: DRFPQDNDLCIPLASSDHLLPATEEAPKVCEACKNKNDDDNDIMETLCKN
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	31 kDa
Gene Name	secreted frizzled related protein 2
Database Link	NP_003004 Entrez Gene 6423 Human UniProt ID Q96HF1
Background	This gene encodes a member ofThe SFRP family that contains a cysteine-rich domain homologous toThe putative Wnt-binding site of Frizzled proteins. SFRPs act as soluble modulators of Wnt signaling. Methylation ofThis gene is a potential marker forThe presence of colorectal cancer. [provided by RefSeq, Jul 2008]
Synonyms	FRP-2; SARP1; SDF-5
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 93%
Reference Data
Protein Families	Secreted Protein
Protein Pathways	Wnt signaling pathway

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.