MRE11 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-MRE11A antibody: synthetic peptide directed towards the N terminal of human MRE11A. Synthetic peptide located within the following region: DTFVTLDEILRLAQENEVDFILLGGDLFHENKPSRKTLHTCLELLRKYCM
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	80 kDa
Gene Name	MRE11 homolog A, double strand break repair nuclease
Database Link	NP_005582 Entrez Gene 4361 Human UniProt ID P49959
Background	This gene encodes a nuclear protein involved in homologous recombination, telomere length maintenance, and DNA double-strand break repair. By itself,The protein has 3' to 5' exonuclease activity and endonuclease activity.The protein forms a complex withThe RAD50 homolog;This complex is required for nonhomologous joining of DNA ends and possesses increased single-stranded DNA endonuclease and 3' to 5' exonuclease activities. In conjunction with a DNA ligase,This protein promotesThe joining of noncomplementary ends in vitro using short homologies nearThe ends ofThe DNA fragments.This gene has a pseudogene on chromosome 3. Alternative splicing ofThis gene results in two transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]
Synonyms	ATLD; HNGS1; MRE11; MRE11B
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Yeast: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Goat: 93%; Zebrafish: 93%
Reference Data
Protein Families	Druggable Genome, Stem cell - Pluripotency
Protein Pathways	Homologous recombination, Non-homologous end-joining

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.