MRE11 (NM_005591) Human Recombinant Protein
CAT#: TP309414
Recombinant protein of human MRE11 meiotic recombination 11 homolog A (S. cerevisiae) (MRE11A), transcript variant 1, 20 µg
View other "MRE11" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 1 publication. |
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC209414 protein sequence
Red=Cloning site Green=Tags(s) MSTADALDDENTFKILVATDIHLGFMEKDAVRGNDTFVTLDEILRLAQENEVDFILLGGDLFHENKPSRK TLHTCLELLRKYCMGDRPVQFEILSDQSVNFGFSKFPWVNYQDGNLNISIPVFSIHGNHDDPTGADALCA LDILSCAGFVNHFGRSMSVEKIDISPVLLQKGSTKIALYGLGSIPDERLYRMFVNKKVTMLRPKEDENSW FNLFVIHQNRSKHGSTNFIPEQFLDDFIDLVIWGHEHECKIAPTKNEQQLFYISQPGSSVVTSLSPGEAV KKHVGLLRIKGRKMNMHKIPLHTVRQFFMEDIVLANHPDIFNPDNPKVTQAIQSFCLEKIEEMLENAERE RLGNSHQPEKPLVRLRVDYSGGFEPFSVLRFSQKFVDRVANPKDIIHFFRHREQKEKTGEEINFGKLITK PSEGTTLRVEDLVKQYFQTAEKNVQLSLLTERGMGEAVQEFVDKEEKDAIEELVKYQLEKTQRFLKERHI DALEDKIDEEVRRFRETRQKNTNEEDDEVREAMTRARALRSQSEESASAFSADDLMSIDLAEQMANDSDD SISAATNKGRGRGRGRRGGRGQNSASRGGSQRGRADTGLETSTRSRNSKTAVSASRNMSIIDAFKSTRQQ PSRNVTTKNYSEVIEVDESDVEEDIFPTTSKTDQRWSSTSSSKIMSQSQVSKGVDFESSEDDDDDPFMNT SSLRRNRR myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 80.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_005582 |
Locus ID | 4361 |
UniProt ID | P49959 |
Refseq Size | 5141 |
Cytogenetics | 11q21 |
Refseq ORF | 2124 |
Synonyms | ATLD; HNGS1; MRE11A; MRE11B |
Summary | This gene encodes a nuclear protein involved in homologous recombination, telomere length maintenance, and DNA double-strand break repair. By itself, the protein has 3' to 5' exonuclease activity and endonuclease activity. The protein forms a complex with the RAD50 homolog; this complex is required for nonhomologous joining of DNA ends and possesses increased single-stranded DNA endonuclease and 3' to 5' exonuclease activities. In conjunction with a DNA ligase, this protein promotes the joining of noncomplementary ends in vitro using short homologies near the ends of the DNA fragments. This gene has a pseudogene on chromosome 3. Alternative splicing of this gene results in two transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Stem cell - Pluripotency |
Protein Pathways | Homologous recombination, Non-homologous end-joining |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
UFL1 promotes histone H4 ufmylation and ATM activation
,Qin, B;Yu, J;Nowsheen, S;Wang, M;Tu, X;Liu, T;Li, H;Wang, L;Lou, Z;,
Nat Commun
,PubMed ID 30886146
[MRE11]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417199 | MRE11A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY417199 | Transient overexpression lysate of MRE11 meiotic recombination 11 homolog A (S. cerevisiae) (MRE11A), transcript variant 1 |
CNY 3,080.00 |
|
PH309414 | MRE11A MS Standard C13 and N15-labeled recombinant protein (NP_005582) |
CNY 19,520.00 |
|
TP761120 | Purified recombinant protein of Human MRE11 meiotic recombination 11 homolog A (S. cerevisiae) (MRE11A), transcript variant 2, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2,040.00 |