Spi1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Sfpi1 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Sfpi1. Synthetic peptide located within the following region: MLQACKMEGFSLTAPPSDDLVTYDSELYQRPMHDYYSFVGSDGESHSDHY
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	31 kDa
Gene Name	spleen focus forming virus (SFFV) proviral integration oncogene
Database Link	NP_035485 Entrez Gene 20375 Mouse UniProt ID P17433
Background	Sfpi1 binds to the PU-box, a purine-rich DNA sequence (5'-GAGGAA-3') that can act as a lymphoid-specific enhancer. This protein is a transcriptional activator that may be specifically involved in the differentiation or activation of macrophages or B-cells. It also binds RNA and may modulate pre-mRNA splicing.
Synonyms	OF; PU.1; SFPI1; SPI-1; SPI-A
Note	Immunogen Sequence Homology: Mouse: 100%; Rat: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.