Dnajb12 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Dnajb12 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: NQKPQSTGDHPQPTDTTHTTTKKAGGTETPSANGEAGGGESAKGYTSEQV
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	42 kDa
Gene Name	DnaJ heat shock protein family (Hsp40) member B12
Database Link	NP_064349 Entrez Gene 56709 Mouse UniProt ID Q9QYI4
Background	The function of this protein remains unknown.
Synonyms	DJ10; DKFZp586B2023; FLJ0027; FLJ20027
Note	Immunogen Sequence Homology: Mouse: 100%; Rat: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.