Dnajb12 (NM_019965) Mouse Recombinant Protein
CAT#: TP505857
Purified recombinant protein of Mouse DnaJ heat shock protein family (Hsp40) member B12 (Dnajb12), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 7,106.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR205857 protein sequence
Red=Cloning site Green=Tags(s) MESNKDEAERCISIALKAIQSNQPERALRFLEKAQRLYPTPRVSALIESLNQKPQSTGDHPQPTDTTHTT TKKAGGTETPSANGEAGGGESAKGYTSEQVAAVKRVKQCKDYYEILGVSRSASDEDLKKAYRKLALKFHP DKNHAPGATEAFKAIGTAYAVLSNPEKRKQYDQFGDDKSQAARHGHSHGDFHRGFEADISPEDLFNMFFG GGFPSSNVHVYSNGRMRYTYQQRQDRRDNQGDGGLGVFVQLMPILILILVSALSQLMVSSPPYSLSPRPS VGHIHKRVTDHLNVAYYVADTFSEEYTGSSLKTVERNVEDDYIANLRNNCWKEKQQKEGLLYRARYFGDT DMYHRAQKMGTPSCNRLSEVQASLHG myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 42 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_064349 |
Locus ID | 56709 |
UniProt ID | Q9QYI4 |
Refseq Size | 1789 |
Cytogenetics | 10 B4 |
Refseq ORF | 1131 |
Synonyms | Dj10; mDj10 |
Summary | Acts as a co-chaperone with HSPA8/Hsc70; required to promote protein folding and trafficking, prevent aggregation of client proteins, and promote unfolded proteins to endoplasmic reticulum-associated degradation (ERAD) pathway. Acts by determining HSPA8/Hsc70's ATPase and polypeptide-binding activities. Can also act independently of HSPA8/Hsc70: together with DNAJB14, acts as a chaperone that promotes maturation of potassium channels KCND2 and KCNH2 by stabilizing nascent channel subunits and assembling them into tetramers. While stabilization of nascent channel proteins is dependent on HSPA8/Hsc70, the process of oligomerization of channel subunits is independent of HSPA8/Hsc70. When overexpressed, forms membranous structures together with DNAJB14 and HSPA8/Hsc70 within the nucleus; the role of these structures, named DJANGOs, is still unclear.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
其它Dnajb12产品