GIMAP5 Rabbit Polyclonal Antibody

CAT#: TA342373

Rabbit Polyclonal Anti-GIMAP5 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5,250.00


货期*
6周

规格
    • 100 ul

Product images

经常一起买 (4)
Transient overexpression lysate of GTPase, IMAP family member 5 (GIMAP5)
    • 100 ug

CNY 3,080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00


Recombinant protein of human GTPase, IMAP family member 5 (GIMAP5), 20 µg
    • 20 ug

CNY 2,900.00
CNY 6,650.00


Recombinant protein of human GTPase, IMAP family member 5 (GIMAP5), 100 µg
    • 100 ug

CNY 9,998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-GIMAP5 antibody: synthetic peptide directed towards the middle region of human GIMAP5. Synthetic peptide located within the following region: CERRYCAFNNWGSVEEQRQQQAELLAVIERLGREREGSFHSNDLFLDAQL
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 35 kDa
Gene Name GTPase, IMAP family member 5
Background This gene encodes a protein belonging to the GTP-binding superfamily and to the immuno-associated nucleotide (IAN) subfamily of nucleotide-binding proteins. In humans, the IAN subfamily genes are located in a cluster at 7q36.1. This gene encodes an antiapoptotic protein that functions in T-cell survival. Polymorphisms in this gene are associated with systemic lupus erythematosus. Read-through transcription exists between this gene and the neighboring upstream GIMAP1 (GTPase, IMAP family member 1) gene. [provided by RefSeq, Dec 2010]
Synonyms HIMAP3; IAN-5; IAN4; IAN4L1; IAN5; IMAP3; IROD
Note Immunogen Sequence Homology: Human: 100%; Mouse: 100%; Rat: 92%; Horse: 92%; Rabbit: 86%
Reference Data
Protein Families Transmembrane
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...