GIMAP5 (NM_018384) Human Recombinant Protein
CAT#: TP303978
Recombinant protein of human GTPase, IMAP family member 5 (GIMAP5), 20 µg
View other "GIMAP5" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203978 protein sequence
Red=Cloning site Green=Tags(s) MGGFQRGKYGTMAEGRSEDNLSATPPALRIILVGKTGCGKSATGNSILGQPVFESKLRAQSVTRTCQVKT GTWNGRKVLVVDTPSIFESQADTQELYKNIGDCYLLSAPGPHVLLLVIQLGRFTAQDTVAIRKVKEVFGT GAMRHVVILFTHKEDLGGQALDDYVANTDNCSLKDLVRECERRYCAFNNWGSVEEQRQQQAELLAVIERL GREREGSFHSNDLFLDAQLLQRTGAGACQEDYRQYQAKVEWQVEKHKQELRENESNWAYKALLRVKHLML LHYEIFVFLLLCSILFFIIFLFIFHYI myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 34.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_060854 |
Locus ID | 55340 |
UniProt ID | Q96F15, A0A090N8P9 |
Refseq Size | 1895 |
Cytogenetics | 7q36.1 |
Refseq ORF | 921 |
Synonyms | HIMAP3; IAN-5; IAN4; IAN4L1; IAN5; IMAP3; IROD |
Summary | This gene encodes a protein belonging to the GTP-binding superfamily and to the immuno-associated nucleotide (IAN) subfamily of nucleotide-binding proteins. In humans, the IAN subfamily genes are located in a cluster at 7q36.1. This gene encodes an antiapoptotic protein that functions in T-cell survival. Polymorphisms in this gene are associated with systemic lupus erythematosus. Read-through transcription exists between this gene and the neighboring upstream GIMAP1 (GTPase, IMAP family member 1) gene. [provided by RefSeq, Dec 2010] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413083 | GIMAP5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY413083 | Transient overexpression lysate of GTPase, IMAP family member 5 (GIMAP5) |
CNY 3,080.00 |
|
PH303978 | GIMAP5 MS Standard C13 and N15-labeled recombinant protein (NP_060854) |
CNY 19,520.00 |