Rab4 (RAB4A) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-RAB4A antibody is: synthetic peptide directed towards the C-terminal region of Human RAB4A. Synthetic peptide located within the following region: VQCARKILNKIESGELDPERMGSGIQYGDAALRQLRSPRRAQAPNAQECG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	24 kDa
Gene Name	RAB4A, member RAS oncogene family
Database Link	NP_004569 Entrez Gene 5867 Human UniProt ID P20338
Background	The function of this protein remains unknown.
Synonyms	HRES-1; HRES1; RAB4
Note	Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Goat: 93%; Horse: 93%; Sheep: 93%; Bovine: 93%; Rabbit: 93%; Rat: 86%; Mouse: 86%; Guinea pig: 86%; Zebrafish: 79%
Reference Data
Protein Families	Druggable Genome
Protein Pathways	Endocytosis

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.