RAB8B Rabbit Polyclonal Antibody

CAT#: TA342690

Rabbit Polyclonal Anti-RAB8B Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 4,628.00


货期*
2周

规格
    • 50 ug

Product images

经常一起买 (4)
Transient overexpression lysate of RAB8B, member RAS oncogene family (RAB8B)
    • 100 ug

CNY 3,080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00


Recombinant protein of human RAB8B, member RAS oncogene family (RAB8B), 20 µg
    • 20 ug

CNY 2,900.00
CNY 6,650.00


Recombinant protein of human RAB8B, member RAS oncogene family (RAB8B), 100 µg
    • 100 ug

CNY 9,998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human, Mouse
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-RAB8B antibody: synthetic peptide directed towards the C terminal of human RAB8B. Synthetic peptide located within the following region: RNIEEHASSDVERMILGNKCDMNDKRQVSKERGEKLAIDYGIKFLETSAK
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 23 kDa
Gene Name RAB8B, member RAS oncogene family
Background RAB proteins, like RAB8B, are low molecular mass monomeric GTPases that localize on the cytoplasmic surfaces of distinct membrane-bound organelles. RAB proteins function in intracellular vesicle transport by aiding in the docking and/or fusion of vesicles with their target membranes (summary by Chen et al., 1997 [PubMed 9030196]).
Synonyms FLJ38125
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%; Goat: 93%; Sheep: 93%
Reference Data
Protein Families Druggable Genome
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...