FGFBP2 Rabbit Polyclonal Antibody

CAT#: TA342998

Rabbit Polyclonal Anti-FGFBP2 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5,250.00


货期*
6周

规格
    • 50 ug

Product images

经常一起买 (4)
Transient overexpression lysate of fibroblast growth factor binding protein 2 (FGFBP2)
    • 100 ug

CNY 3,080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00


Recombinant protein of human fibroblast growth factor binding protein 2 (FGFBP2), 20 µg
    • 20 ug

CNY 2,900.00
CNY 6,650.00


Recombinant protein of human fibroblast growth factor binding protein 2 (FGFBP2), 100 µg
    • 100 ug

CNY 9,998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-FGFBP2 antibody: synthetic peptide directed towards the C terminal of human FGFBP2. Synthetic peptide located within the following region: LGKAKPTTRPTAKPTQPGPRPGGNEEAKKKAWEHCWKPFQALCAFLISFF
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 24 kDa
Gene Name fibroblast growth factor binding protein 2
Background FGFBP2 is a member of the fibroblast growth factor binding protein family. The encoded protein is a serum protein that is selectively secreted by cytotoxic lymphocytes and may be involved in cytotoxic lymphocyte-mediated immunity. An increase in the amount of gene product may be associated with atopic asthma and mild extrinsic asthma.
Synonyms HBP17RP; KSP37
Note Immunogen Sequence Homology: Human: 100%
Reference Data
Protein Families Secreted Protein
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...