ATCAY Rabbit Polyclonal Antibody
CAT#: TA343082
Rabbit Polyclonal Anti-ATCAY Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5,250.00
CNY 300.00
CNY 1,430.00
CNY 2,900.00
CNY 6,650.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-ATCAY antibody is: synthetic peptide directed towards the C-terminal region of Human ATCAY. Synthetic peptide located within the following region: LQYEEERLKARRESARPQPEFVLPRSEEKPEVAPVENRSALVSEDQETSM |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 42 kDa |
Gene Name | ataxia, cerebellar, Cayman type |
Database Link | |
Background | This gene encodes a neuron-restricted protein that contains a CRAL-TRIO motif common to proteins that bind small lipophilic molecules. Mutations in this gene are associated with cerebellar ataxia, Cayman type. |
Synonyms | BNIP-H; CLAC |
Note | Immunogen Sequence Homology: Human: 100%; Rat: 79%; Mouse: 79% |
Reference Data | |
Protein Families | Transmembrane |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |