CMG1 (IFT74) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Rat
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Ift74 antibody is: synthetic peptide directed towards the middle region of RAT Ift74. Synthetic peptide located within the following region: NMSPEKQVKYIEMKTTNEKLLQELDTLQQQLDSLNIKKESLETEIAHSQV
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	66 kDa
Gene Name	intraflagellar transport 74
Database Link	NP_079379 Entrez Gene 313365 Rat UniProt ID Q96LB3
Background	The function of this protein remains unknown.
Synonyms	BBS20; CCDC2; CMG-1; CMG1
Note	Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%; Rat: 86%; Horse: 86%; Yeast: 83%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.