Nr5a2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Rat
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Nr5a2 antibody is: synthetic peptide directed towards the C-terminal region of Rat Nr5a2. Synthetic peptide located within the following region: QTEKFGQLLLRLPEIRAISKQAEDYLYYKHVNGDVPYNNLLIEMLHAKRA
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	64 kDa
Gene Name	nuclear receptor subfamily 5, group A, member 2
Database Link	NP_068510 Entrez Gene 60349 Rat UniProt ID Q9QWM1
Background	Nr5a2 is an orphan nuclear receptor that may bind DNA and activate gene transcription.
Synonyms	B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta; hB1F; hB1F-2; LRH-1; LRH1
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Rat: 93%; Mouse: 93%; Zebrafish: 93%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.