Ciao1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Ciao1 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Ciao1. Synthetic peptide located within the following region: MKDSLVLQSRVPAHPDSRCWFLAWNPSGTLLASCGGDRKIRIWGTEGDSW
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	38 kDa
Gene Name	cytosolic iron-sulfur protein assembly 1
Database Link	NP_079572 Entrez Gene 26371 Mouse UniProt ID Q99KN2
Background	Ciao1 is an essential component of the cytosolic iron-sulfur (Fe/S) protein assembly machinery. It is required for the maturation of extramitochondrial Fe/S proteins. Seems to specifically modulate the transactivation activity of WT1. As part of the mitotic spindle-associated MMXD complex it may play a role in chromosome segregation.
Synonyms	CIA1; WDR39
Note	Immunogen Sequence Homology: Rat: 100%; Human: 100%; Dog: 93%; Horse: 93%; Mouse: 93%; Rabbit: 93%; Zebrafish: 86%; Pig: 79%; Bovine: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.