PMF1 Rabbit Polyclonal Antibody
CNY 5,250.00
CNY 300.00
CNY 1,430.00
CNY 2,900.00
CNY 6,650.00
Specifications
Product Data | |
Applications | IHC, WB |
Recommend Dilution | WB, IHC |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-PMF1 antibody: synthetic peptide directed towards the N terminal of human PMF1. Synthetic peptide located within the following region: MVDTFLQKLVAAGSYQRFTDCYKCFYQLQPAMTQRIYDKFIAQLQTSIRE |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 19 kDa |
Gene Name | polyamine-modulated factor 1 |
Database Link | |
Background | PMF1 is part of the MIS12 complex which is required for normal chromosome alignment and segregation and kinetochore formation during mitosis. It may act as a cotranscription partner of NFE2L2 involved in regulation of polyamine-induced transcription of SSAT. |
Synonyms | Est1p-like protein B (EST1B); OTTHUMP00000016581; polyamine-modulated factor 1 |
Note | Immunogen Sequence Homology: Goat: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Human: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 92%; Rat: 85%; Mouse: 77% |
Reference Data | |
Protein Families | Stem cell - Pluripotency |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |