EXOSC7 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-EXOSC7 antibody: synthetic peptide directed towards the N terminal of human EXOSC7. Synthetic peptide located within the following region: LEKPNEGYLEFFVDCSASATPEFEGRGGDDLGTEIANTLYRIFNNKSSVD
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	32 kDa
Gene Name	exosome component 7
Database Link	NP_055819 Entrez Gene 23016 Human UniProt ID Q15024
Background	EXOSC7 belongs to the RNase PH family. It is a component of the exosome 3'->5' exoribonuclease complex and is required for the 3' processing of the 7S pre-RNA to the mature 5.8S rRNA.
Synonyms	EAP1; hRrp42p; p8; RRP42; Rrp42p
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 79%
Reference Data
Protein Families	Stem cell - Pluripotency
Protein Pathways	RNA degradation

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.