NSUN6 Rabbit Polyclonal Antibody

CAT#: TA344029

Rabbit Polyclonal Anti-NSUN6 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5,250.00


货期*
6周

规格
    • 100 ul

Product images

经常一起买 (4)
Transient overexpression lysate of NOP2/Sun domain family, member 6 (NSUN6)
    • 100 ug

CNY 3,080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00


Recombinant protein of human NOL1/NOP2/Sun domain family, member 6 (NSUN6), 20 µg
    • 20 ug

CNY 2,900.00
CNY 6,650.00


Recombinant protein of human NOL1/NOP2/Sun domain family, member 6 (NSUN6), 100 µg
    • 100 ug

CNY 9,998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-NSUN6 antibody: synthetic peptide directed towards the N terminal of human NSUN6. Synthetic peptide located within the following region: MSIFPKISLRPEVENYLKEGFMNKEIVTALGKQEAERKFETLLKHLSHPP
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 52 kDa
Gene Name NOP2/Sun RNA methyltransferase family member 6
Background NSUN6 may have S-adenosyl-L-methionine-dependent methyl-transferase activity (Potential). NSUN6 belongs to the methyltransferase superfamily, RsmB/NOP family. It contains 1 PUA domain.Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests.
Synonyms 4933414E04Rik; ARL5B-AS1; NOPD1
Note Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Pig: 92%; Horse: 92%; Bovine: 92%; Guinea pig: 91%; Dog: 86%; Yeast: 75%
Reference Data
Protein Families Druggable Genome
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...