Wnt10a Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC
Recommend Dilution	WB, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Wnt10a antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: RDQRWNCSSLETRNKVPYESPIFSRGFRESAFAYAIAAAGVVHAVSNACA
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	46 kDa
Gene Name	wingless-type MMTV integration site family, member 10A
Database Link	NP_033544 Entrez Gene 80326 Human UniProt ID P70701
Background	Wnt10a is the ligand for members of the frizzled family of seven transmembrane receptors. Wnt10a is a probable developmental protein. Wnt10a may be a signaling molecule important in CNS development. Wnt10a is likely to signal over only few cell diameters.
Synonyms	FLJ14301; SSPS
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%; Mouse: 93%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.