BMP6 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human, Rat
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-BMP6 antibody: synthetic peptide directed towards the middle region of human BMP6. Synthetic peptide located within the following region: MVAFFKVSEVHVRTTRSASSRRRQQSRNRSTQSQDVARVSSASDYNSSEL
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	57 kDa
Gene Name	bone morphogenetic protein 6
Database Link	NP_001709 Entrez Gene 25644 RatEntrez Gene 654 Human UniProt ID P22004
Background	The bone morphogenetic proteins (BMPs) are a family of secreted signaling molecules that can induce ectopic bone growth. Many BMPs are part of the transforming growth factor-beta (TGFB) superfamily. BMPs were originally identified by an ability of deminer
Synonyms	VGR; VGR1
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Goat: 77%; Sheep: 77%; Bovine: 77%
Reference Data
Protein Families	Adult stem cells, Cancer stem cells, Druggable Genome, Embryonic stem cells, ES Cell Differentiation/IPS, Induced pluripotent stem cells, Secreted Protein, Stem cell relevant signaling - TGFb/BMP signaling pathway
Protein Pathways	Hedgehog signaling pathway, TGF-beta signaling pathway

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.