Dematin (DMTN) Rabbit Polyclonal Antibody

CAT#: TA344235

Rabbit Polyclonal Anti-DMTN Antibody - C-terminal region



Need it in bulk or conjugated?
Get a free quote

CNY 5,250.00


货期*
6周

规格
    • 100 ul

Product images

经常一起买 (5)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00


Recombinant protein of human erythrocyte membrane protein band 4.9 (dematin) (EPB49), transcript variant 1, 20 µg
    • 20 ug

CNY 2,900.00
CNY 6,650.00


Transient overexpression lysate of erythrocyte membrane protein band 4.9 (dematin) (EPB49), transcript variant 6
    • 100 ug

CNY 3,080.00


Recombinant protein of human erythrocyte membrane protein band 4.9 (dematin) (EPB49), transcript variant 1, 100 µg
    • 100 ug

CNY 9,998.00


Transient overexpression lysate of erythrocyte membrane protein band 4.9 (dematin) (EPB49), transcript variant 1
    • 100 ug

CNY 3,080.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for Anti-DMTN antibody is: synthetic peptide directed towards the C-terminal region of Human DMTN. Synthetic peptide located within the following region: KGRTKLPPGVDRMRLERHLSAEDFSRVFAMSPEEFGKLALWKRNELKKKA
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 42 kDa
Gene Name dematin actin binding protein
Background Dematin, or EPB49, is an actin-bundling protein originally identified in the erythroid membrane skeleton. Its actin-bundling activity is abolished upon phosphorylation by cAMP-dependent protein kinase and is restored after dephosphorylation.
Synonyms DMT; EPB49
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 93%; Rabbit: 92%; Zebrafish: 85%
Reference Data
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...