EVX1 Rabbit Polyclonal Antibody

CAT#: TA344515

Rabbit Polyclonal Anti-EVX1 Antibody - N-terminal region



Need it in bulk or conjugated?
Get a free quote

CNY 5,250.00


货期*
6周

规格
    • 100 ul

Product images

经常一起买 (2)
Transient overexpression lysate of even-skipped homeobox 1 (EVX1)
    • 100 ug

CNY 3,080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-EVX1 antibody: synthetic peptide directed towards the N terminal of human EVX1. Synthetic peptide located within the following region: PEPPEKMVPRGCLSPRAVPPATRERGGGGPEEEPVDGLAGSAAGPGAEPQ
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 42 kDa
Gene Name even-skipped homeobox 1
Background EVX1 is a member of the even-skipped homeobox family characterized by the presence of a homeodomain closely related to the Drosophila even-skipped (eve) segmentation gene of the pair-rule class. The protein may play an important role as a transcriptional repressor during embryogenesis.This gene encodes a member of the even-skipped homeobox family characterized by the presence of a homeodomain closely related to the Drosophila even-skipped (eve) segmentation gene of the pair-rule class. The encoded protein may play an important role as a transcriptional repressor during embryogenesis. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-343 AC004080.2 115915-116257 344-1717 X60655.1 86-1459 1718-1858 AC004080.2 119803-119943
Synonyms EVX-1
Note Immunogen Sequence Homology: Human: 100%; Horse: 93%; Rabbit: 92%; Dog: 86%; Pig: 86%; Bovine: 86%; Guinea pig: 86%; Goat: 80%; Rat: 79%; Mouse: 79%
Reference Data
Protein Families ES Cell Differentiation/IPS
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...