KLF8 Rabbit Polyclonal Antibody
CAT#: TA344524
Rabbit Polyclonal Anti-KLF8 Antibody - N-terminal region
Need it in bulk or conjugated?
Get a free quote
CNY 5,250.00
CNY 3,080.00
CNY 300.00
CNY 1,430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-KLF8 antibody: synthetic peptide directed towards the N terminal of human KLF8. Synthetic peptide located within the following region: LLASDFSLPQVEPVDLSFHKPKAPLQPASMLQAPIRPPKPQSSPQTLVVS |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 39 kDa |
Gene Name | Kruppel-like factor 8 |
Database Link | |
Background | KLF8 is abnormally expressed in female patients with X autosome translocation t(X;21)(p11.2;q22.3) and non-syndromic mental retardation. |
Synonyms | BKLF3; ZNF741 |
Note | Immunogen Sequence Homology: Human: 100%; Rabbit: 93%; Pig: 90%; Rat: 86%; Guinea pig: 86%; Mouse: 79% |
Reference Data | |
Protein Families | Transcription Factors |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |