SPDYE1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-SPDYE1 antibody is: synthetic peptide directed towards the C-terminal region of Human SPDYE1. Synthetic peptide located within the following region: RCMNPRARKNRSQIVLFQKRRFHFFCSMSCRAWVSPEELEEIQAYDPEHW
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	36 kDa
Gene Name	speedy/RINGO cell cycle regulator family member E1
Database Link	NP_778234 Entrez Gene 285955 Human UniProt ID Q8NFV5
Background	This gene is located at chromosome 7p13 which is close to the Williams Beuren syndrome chromosome region 7q11.23.
Synonyms	Ringo1; SPDYE; WBSCR19
Note	Immunogen Sequence Homology: Human: 100%; Rat: 92%; Mouse: 92%; Rabbit: 92%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.