CHMP1B Rabbit Polyclonal Antibody

CAT#: TA344782

Rabbit Polyclonal Anti-CHMP1B Antibody - N-terminal region



Need it in bulk or conjugated?
Get a free quote

CNY 5,250.00


货期*
6周

规格
    • 50 ug

Product images

经常一起买 (2)
Transient overexpression lysate of chromatin modifying protein 1B (CHMP1B)
    • 100 ug

CNY 3,080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-CHMP1B antibody: synthetic peptide directed towards the N terminal of human CHMP1B. Synthetic peptide located within the following region: KIKKAIQKGNMEVARIHAENAIRQKNQAVNFLRMSARVDAVAARVQTAVT
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 22 kDa
Gene Name charged multivesicular body protein 1B
Background CHMP1B belongs to the chromatin-modifying protein/charged multivesicular body protein (CHMP) family. These proteins are components of ESCRT-III (endosomal sorting complex required for transport III), a complex involved in degradation of surface receptor proteins and formation of endocytic multivesicular bodies (MVBs). Some CHMPs have both nuclear and cytoplasmic/vesicular distributions, and one such CHMP, CHMP1A (MIM 164010), is required for both MVB formation and regulation of cell cycle progression (Tsang et al., 2006 [PubMed 16730941]).
Synonyms C10orf2; C18-ORF2; C18orf2; CHMP1.5; hVps46-2; Vps46-2; Vps46B
Note Immunogen Sequence Homology: Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Zebrafish: 100%; Pig: 93%; Guinea pig: 93%
Reference Data
Protein Families Druggable Genome
Protein Pathways Endocytosis
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...