OGDHL Rabbit Polyclonal Antibody
CAT#: TA344893
Rabbit Polyclonal Anti-OGDHL Antibody - N-terminal region
Need it in bulk or conjugated?
Get a free quote
CNY 5,250.00
CNY 300.00
CNY 1,430.00
CNY 2,900.00
CNY 6,650.00
CNY 4,840.00
CNY 9,998.00
CNY 3,080.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-OGDHL antibody: synthetic peptide directed towards the N terminal of human OGDHL. Synthetic peptide located within the following region: VFGWRSRSSGPPATFPSSKGGGGSSYMEEMYFAWLENPQSVHKSWDSFFR |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 114 kDa |
Gene Name | oxoglutarate dehydrogenase-like |
Database Link | |
Background | The function of OGDHL remains unknown. |
Synonyms | FLJ10851 |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Human: 100%; Horse: 92%; Rat: 85%; Bovine: 85% |
Reference Data | |
Protein Pathways | Citrate cycle (TCA cycle), Lysine degradation, Metabolic pathways, Tryptophan metabolism |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |