LASS4 (CERS4) Rabbit Polyclonal Antibody
CAT#: TA345387
Rabbit Polyclonal Anti-LASS4 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4,628.00
CNY 300.00
CNY 1,430.00
CNY 2,900.00
CNY 6,650.00
CNY 9,998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-LASS4 antibody: synthetic peptide directed towards the N terminal of human LASS4. Synthetic peptide located within the following region: MLSSFNEWFWQDRFWLPPNVTWTELEDRDGRVYPHPQDLLAALPLALVLL |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 46 kDa |
Gene Name | ceramide synthase 4 |
Database Link | |
Background | LASS4 may be either a bona fide (dihydro)ceramide synthase or a modulator of its activity. When overexpressed in cells it is involved in the production of sphingolipids containing different fatty acid donnors (N-linked stearoyl- (C18) or arachidoyl- (C20) ceramides) in a fumonisin B1-independent manner. |
Synonyms | LASS4; Trh1 |
Note | Immunogen Sequence Homology: Human: 100%; Mouse: 93%; Pig: 86%; Rat: 86%; Dog: 79%; Horse: 79% |
Reference Data | |
Protein Families | Transcription Factors, Transmembrane |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |