LASS4 (CERS4) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-LASS4 antibody: synthetic peptide directed towards the N terminal of human LASS4. Synthetic peptide located within the following region: MLSSFNEWFWQDRFWLPPNVTWTELEDRDGRVYPHPQDLLAALPLALVLL
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	46 kDa
Gene Name	ceramide synthase 4
Database Link	NP_078828 Entrez Gene 79603 Human UniProt ID Q9HA82
Background	LASS4 may be either a bona fide (dihydro)ceramide synthase or a modulator of its activity. When overexpressed in cells it is involved in the production of sphingolipids containing different fatty acid donnors (N-linked stearoyl- (C18) or arachidoyl- (C20) ceramides) in a fumonisin B1-independent manner.
Synonyms	LASS4; Trh1
Note	Immunogen Sequence Homology: Human: 100%; Mouse: 93%; Pig: 86%; Rat: 86%; Dog: 79%; Horse: 79%
Reference Data
Protein Families	Transcription Factors, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.