PHOSPHO2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-PHOSPHO2 antibody: synthetic peptide directed towards the N terminal of human PHOSPHO2. Synthetic peptide located within the following region: MKILLVFDFDNTIIDDNSDTWIVQCAPNKKLPIELRDSYRKGFWTEFMGR
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	28 kDa
Gene Name	phosphatase, orphan 2
Database Link	NP_001008489 Entrez Gene 493911 Human UniProt ID Q8TCD6
Background	PHOSPHO2 is a phosphatase that has high activity toward pyridoxal 5'-phosphate (PLP). PHOSPHO2 also active at much lower level toward pyrophosphate, phosphoethanolamine (PEA), phosphocholine (PCho), phospho-l-tyrosine, fructose-6-phosphate, p-nitrophenyl phosphate, and h-glycerophosphate.
Synonyms	MGC22679; MGC111048
Note	Immunogen Sequence Homology: Human: 100%; Pig: 92%; Rat: 79%; Mouse: 79%; Dog: 77%; Bovine: 77%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.