SERBP1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-SERBP1 antibody: synthetic peptide directed towards the C terminal of human SERBP1. Synthetic peptide located within the following region: PNEGADGQWKKGFVLHKSKSEEAHAEDSVMDHHFRKPANDITSQLEINFG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	45 kDa
Gene Name	SERPINE1 mRNA binding protein 1
Database Link	NP_001018077 Entrez Gene 26135 Human UniProt ID Q8NC51
Background	SERBP1 may play a role in the regulation of mRNA stability. It binds to the 3'-most 134 nt of the SERPINE1/PAI1 mRNA, a region which confers cyclic nucleotide regulation of message decay.
Synonyms	CGI-55; CHD3IP; HABP4L; PAI-RBP1; PAIRBP1
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Horse: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.