SRP54 Rabbit Polyclonal Antibody
CAT#: TA345834
Rabbit Polyclonal Anti-SRP54 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5,200.00
CNY 300.00
CNY 1,430.00
CNY 2,900.00
CNY 6,650.00
CNY 3,080.00
CNY 9,998.00
CNY 3,080.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-SRP54 antibody: synthetic peptide directed towards the middle region of human SRP54. Synthetic peptide located within the following region: ENFEIIIVDTSGRHKQEDSLFEEMLQVANAIQPDNIVYVMDASIGQACEA |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 56 kDa |
Gene Name | signal recognition particle 54kDa |
Database Link | |
Background | SRP54 belongs to the GTP-binding SRP family. It binds to the signal sequence of presecretory protein when they emerge from the ribosomes and transfers them to TRAM (translocating chain-associating membrane protein). |
Synonyms | signal recognition particle 54kDa |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%; Goat: 93% |
Reference Data | |
Protein Pathways | Protein export |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |